PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_79356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 305aa    MW: 31604.5 Da    PI: 8.0671
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_79356.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022151.7e-66972393154
        DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssa.eskk 98 
                   +gt+sCqdCGnqakkdC h+RCRtCCksrgfdCathvkstWvpaa+rrer++q+ +a        ++++ kr+re    + s+++ t++ss+ ++++
  MLOC_79356.1  97 AGTISCQDCGNQAKKDCPHMRCRTCCKSRGFDCATHVKSTWVPAARRRERHHQQPQA--------SAEQFKRPREG--GQPSSTTPTTTSSGeHQQQ 183
                   7899**********************************************7776655........56678999986..4444444444555405666 PP

        DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   ++ + ++P+evsseavfrcvr++ vd++++e+aYqtavsigGhvfkGiL+d G+++
  MLOC_79356.1 184 MMAADRFPREVSSEAVFRCVRLGPVDEADAEVAYQTAVSIGGHVFKGILHDVGPDT 239
                   778889***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-6199238IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.4E-27101143IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.8E-22189237IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAGFPLGGGG HHSRGARDDD GSHPPGINPS ASSSSAAAFL YATTPSRGGF QLWQGQPQHE  60
QQQHPFYGGP SSSIIRFADD PAASGSSSRG GGRGSGAGTI SCQDCGNQAK KDCPHMRCRT  120
CCKSRGFDCA THVKSTWVPA ARRRERHHQQ PQASAEQFKR PREGGQPSST TPTTTSSGEH  180
QQQMMAADRF PREVSSEAVF RCVRLGPVDE ADAEVAYQTA VSIGGHVFKG ILHDVGPDTS  240
ITRTGHHAAE GSSPSTAAAG GAEGGSGSTG AAAVSSSAVV MDPYPTPGPY GAYGGAPFFH  300
GHHPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3735250.0AK373525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3033N03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974131.11e-100PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLM0Z9160.0M0Z916_HORVD; Uncharacterized protein
STRINGMLOC_79356.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.18e-49Lateral root primordium (LRP) protein-related